PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009758525.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 394aa    MW: 41775.9 Da    PI: 9.7839
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009758525.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.9e-3979139363
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                     e+alkcprC+s+ntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+sss
  XP_009758525.1  79 ETALKCPRCESSNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSSS 139
                     6789*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3462131IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3281136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.57182136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MVFSSIPAYL DPTNWQQQSG GSIPNHHQLT SPLSQSATPP SLPPPPPPLQ PHGSSGGAGS  60
IRPGSMADRA RLANIPMPET ALKCPRCESS NTKFCYFNNY SLSQPRHFCK TCRRYWTRGG  120
ALRNVPVGGG CRRNKRSSSK SSNNNSNNTS KSPASSTSTD GRQAANNNSG STSTISSHSN  180
SFSGPTSAAS LLGLMSPQIP PLRFLSPLGQ LTDHHHHHQF STPGNNMNLN FSTSGNVLGG  240
SSEGMMVNNN NLLGAGAGAG AGGGVASFLS SVNVEHWRMQ QQQMAQQFPN FIGGFDQSNS  300
PSGINNYQFQ GGVNEGVQFL GGNESTTSQI RPKISTSMLN QMASVKMEDN NHNQDQSALS  360
RQLLGIQGNE NWNTASAWSD LSASFSSSST SNAL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758525.10.0PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_016465077.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLK4CR951e-150K4CR95_SOLLC; Uncharacterized protein
STRINGSolyc09g010680.2.11e-150(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.13e-45DNA binding with one finger 2.4